Burkholderia mallei FMH 23344: DM51_4786 Help Entry DM51_4786         CDS       T03523                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bmaf  Burkholderia mallei FMH 23344 Pathway bmaf00261   Monobactam biosynthesis bmaf01100   Metabolic pathways bmaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmaf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM51_4786  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmaf01008]     DM51_4786 Polyketide biosynthesis proteins [BR:bmaf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM51_4786 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIP73477 LinkDB All DBs Position 2:complement(1909357..1909563) Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgatggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggctggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system