Burkholderia mallei FMH 23344: DM51_917 Help Entry DM51_917          CDS       T03523                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bmaf  Burkholderia mallei FMH 23344 Pathway bmaf00261   Monobactam biosynthesis bmaf01100   Metabolic pathways bmaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmaf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM51_917  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmaf01008]     DM51_917 Polyketide biosynthesis proteins [BR:bmaf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM51_917 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIP78109 LinkDB All DBs Position 1:complement(1047016..1047258) Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPADADDVVYAVVVNDEEQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgacgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaagaacagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system