Burkholderia mallei 23344: DM55_4550 Help Entry DM55_4550         CDS       T03323                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bmal  Burkholderia mallei 23344 Pathway bmal00261   Monobactam biosynthesis bmal01100   Metabolic pathways bmal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM55_4550 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmal01008]     DM55_4550 (mbtH) Polyketide biosynthesis proteins [BR:bmal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM55_4550 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO54513 LinkDB All DBs Position 2:1612562..1612768 Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgatggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggctggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system