Bombyx mandarina (wild silkworm): 804646 Help Entry 804646            CDS       T05882                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism bman  Bombyx mandarina (wild silkworm) Pathway bman00190   Oxidative phosphorylation bman01100   Metabolic pathways Module bman_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:bman00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     804646 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bman03029]     804646 (ND4L) Enzymes [BR:bman01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      804646 (ND4L) Mitochondrial biogenesis [BR:bman03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     804646 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 SPP Motif Other DBs NCBI-GeneID:  804646 NCBI-ProteinID:  NP_570620 UniProt:  Q8SEY4 LinkDB All DBs AA seq 96 aa AA seqDB search MLIYDIWFLFIYMFFIGNLIFVSKNKHLLVVLLSLEFIVLSIFFFFLVLLMFIDYDMYML MVFLVFSVCEGSLGLSILVSMIRSHGNDYFQSFSML NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgttaatttatgatatttgatttttatttatttatatgttttttatcggtaatttaatt tttgtttctaaaaataaacatttattggttgttctattaagattagaatttattgtttta agaattttttttttttttttagttttattgatatttattgattatgatatatatatatta atagtttttttagttttttctgtttgtgagggttctttaggtttatcaattttagtttca ataattcgtagacatggtaatgattattttcaaagatttagaatattataa

DBGET integrated database retrieval system