Burkholderia mallei BMQ: DM76_3013 Help Entry DM76_3013         CDS       T03490                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bmaq  Burkholderia mallei BMQ Pathway bmaq00261   Monobactam biosynthesis bmaq01100   Metabolic pathways bmaq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmaq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM76_3013  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmaq01008]     DM76_3013 Polyketide biosynthesis proteins [BR:bmaq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM76_3013 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO62031 LinkDB All DBs Position 1:3316673..3316897 Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system