Burkholderia mallei BMQ: DM76_3502 Help Entry DM76_3502         CDS       T03490                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bmaq  Burkholderia mallei BMQ Pathway bmaq00261   Monobactam biosynthesis bmaq01100   Metabolic pathways bmaq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmaq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM76_3502 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmaq01008]     DM76_3502 (mbtH) Polyketide biosynthesis proteins [BR:bmaq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM76_3502 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO60579 LinkDB All DBs Position 2:371367..371573 Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgatggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggctggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system