Brucella melitensis bv. 1 16M: BMEI0955 Help Entry BMEI0955          CDS       T00072                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bme  Brucella melitensis bv. 1 16M Pathway bme00790   Folate biosynthesis bme01100   Metabolic pathways bme01240   Biosynthesis of cofactors Module bme_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bme00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BMEI0955 Enzymes [BR:bme01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BMEI0955  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BMEI0955  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BMEI0955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAL52136 UniProt:  Q8YH49 LinkDB All DBs Position I:complement(991419..991778) Genome browser AA seq 119 aa AA seqDB search MYTIRIMNCAFFAHHGVFDEEHKLGQRFYVDAVLDVDEGNSLESDNIDGTVHYGIAFSVI EGIIMGRQRYLIETLALDVAKALVARFPQIKRAEITIRKPNAPVSGVLDYVEVTVVYPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtgtacacgatccgcatcatgaactgtgccttttttgcgcatcacggtgtcttcgatgaa gaacacaagctcggacaacgattctatgtcgatgccgttctggatgttgatgagggcaac tcgctggaaagcgacaatattgacggaacagttcattacggaattgccttctccgtcatt gaaggcatcatcatgggccgccagcgttatctgatcgaaaccctcgcgcttgatgtcgcc aaggcgctcgtcgcacggtttcctcagataaagcgggctgagatcacgatccgcaagccg aatgccccggtttcgggcgtcctcgattatgtggaagtaaccgtggtttacccccagtga

DBGET integrated database retrieval system