Burkholderia mallei NCTC 10229: BMA10229_0306 Help Entry BMA10229_0306     CDS       T00471                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bml  Burkholderia mallei NCTC 10229 Pathway bml00261   Monobactam biosynthesis bml01100   Metabolic pathways bml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bml00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BMA10229_0306  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bml01008]     BMA10229_0306 Polyketide biosynthesis proteins [BR:bml01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BMA10229_0306 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABN00272 UniProt:  A2RWR1 LinkDB All DBs Position II:301916..302122 Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgatggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggctggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system