Burkholderia multivorans ATCC BAA-247: NP80_1726 Help Entry NP80_1726         CDS       T03881                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bmul  Burkholderia multivorans ATCC BAA-247 Pathway bmul00261   Monobactam biosynthesis bmul01100   Metabolic pathways bmul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmul00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NP80_1726  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmul01008]     NP80_1726 Polyketide biosynthesis proteins [BR:bmul01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NP80_1726 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJY19630 LinkDB All DBs Position 1:1845721..1845963 Genome browser AA seq 80 aa AA seqDB search MTQATTPSADSDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVRGAKADCLAHIETVWT DMRPASLRRAMDGERAPNAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgactccgacgatctcgtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgc gaggtgggcgtgcgcggcgcgaaggccgactgtctcgcgcacatcgaaaccgtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgccgaacgcatcg tga

DBGET integrated database retrieval system