Peribacillus muralis: ABE28_001175 Help Entry ABE28_001175      CDS       T05340                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bmur  Peribacillus muralis Pathway bmur00261   Monobactam biosynthesis bmur01100   Metabolic pathways bmur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmur00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ABE28_001175  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmur01008]     ABE28_001175 Polyketide biosynthesis proteins [BR:bmur01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ABE28_001175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AOH52970 UniProt:  A0A1B3XID2 LinkDB All DBs Position 231896..232117 Genome browser AA seq 73 aa AA seqDB search MTNPFENENGIYNVLINEEGQHSLWPAFLVIPSGWSVIYREESRRACLEYISTNWTDLQP KSLKLVASSDGTK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccctttcgagaatgaaaatggcatctacaatgtattgataaatgaagaaggt cagcattccctatggcccgcttttctggttattccatccggctggtccgtcatataccga gaggagagccgccgggcttgcttggagtacattagtacgaactggacggacttgcagcca aaaagcttgaagctagttgccagcagtgatggaacaaagtga

DBGET integrated database retrieval system