Brucella melitensis NI: BMNI_II0478 Help Entry BMNI_II0478       CDS       T01853                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bmw  Brucella melitensis NI Pathway bmw00190   Oxidative phosphorylation bmw01100   Metabolic pathways bmw02020   Two-component system Module bmw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bmw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BMNI_II0478  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BMNI_II0478 Enzymes [BR:bmw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BMNI_II0478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AEQ10188 LinkDB All DBs Position II:472297..472452 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system