Bacillus pseudomycoides 219298: DJ92_4948 Help Entry DJ92_4948         CDS       T03239                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bmyc  Bacillus pseudomycoides 219298 Pathway bmyc00261   Monobactam biosynthesis bmyc01100   Metabolic pathways bmyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmyc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DJ92_4948 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmyc01008]     DJ92_4948 (mbtH) Polyketide biosynthesis proteins [BR:bmyc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DJ92_4948 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIK36596 UniProt:  A0A1S9WQI9 LinkDB All DBs Position 4841685..4841906 Genome browser AA seq 73 aa AA seqDB search MTNPFENDNFMYKVLVNKEGQHSVWPAFLDVPAGWDVVHEQDSRQACLAYIELHWSDMQP KSLHSLECVSVGE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaacgataactttatgtataaagtgttagtaaataaggaaggc cagcattctgtctggccagcctttctcgatgtaccagccgggtgggatgttgttcatgaa caagatagtagacaagcttgtcttgcgtatatcgaattacactggagtgatatgcagcca aagagtcttcactcacttgagtgcgtttcagtaggggagtag

DBGET integrated database retrieval system