Bacteroides nordii: K8P02_04750 Help Entry K8P02_04750       CDS       T07941                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bno  Bacteroides nordii Pathway bno00020   Citrate cycle (TCA cycle) bno00720   Other carbon fixation pathways bno01100   Metabolic pathways bno01110   Biosynthesis of secondary metabolites bno01120   Microbial metabolism in diverse environments bno01200   Carbon metabolism bno01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bno00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K8P02_04750   09102 Energy metabolism    00720 Other carbon fixation pathways     K8P02_04750 Enzymes [BR:bno01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K8P02_04750 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_2 Fer4_6 Fer4_7 LdpA_Fe-S-bd Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_8 Fer4_22 Fer4_20 Fer4_3 DUF5651 Motif Other DBs NCBI-ProteinID:  UAK43608 LinkDB All DBs Position complement(1262902..1263129) Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLDVISLTKEVNVKGYNYARQVLEDTCNGCSSCAT VCPDGCISVYKVKVD NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaattaaaggagcaatcgtggtcgacacggagcgttgcaaaggttgcaacctg tgtgtagtggcttgtccgctcgatgtaatatcactcaccaaagaggtgaatgtaaagggg tacaattatgcccgccaagtattggaagatacctgcaacggatgcagttcgtgtgcaacg gtctgtccggacggatgtatctctgtgtataaagttaaagtagattag

DBGET integrated database retrieval system