Bacteroides nordii: K8P02_13680 Help Entry K8P02_13680       CDS       T07941                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bno  Bacteroides nordii Pathway bno00790   Folate biosynthesis bno01100   Metabolic pathways bno01240   Biosynthesis of cofactors Module bno_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bno00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     K8P02_13680 (folB) Enzymes [BR:bno01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      K8P02_13680 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      K8P02_13680 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      K8P02_13680 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  UAK41257 LinkDB All DBs Position 3492626..3492997 Genome browser AA seq 123 aa AA seqDB search MNINASYIHLENILFFAHHGVATQETIVGNEFYINLRLKVDFAHAITTDAVEDTVSYADV YTLLKEEMGIPSKLLEHVCGRIAERLFRDFPAIEEVEIKLSKRNPPMGADIDAAGVEMFC TRA NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaatataaacgccagttatatacatttagagaatatactcttctttgcccatcacgga gtagctacacaagaaacgattgtggggaatgagttttatatcaatctgagattaaaagtc gacttcgcacacgccattacgacagatgcagtagaggatactgtgagttatgccgacgta tataccctattgaaagaagaaatgggaatcccctccaagctgttggaacatgtatgcgga cgtattgcagaaagattattccgggattttcctgccattgaagaagtagaaataaagttg tccaaacggaatccacccatgggagcagatattgatgcggcaggtgtggagatgttttgc accagagcatga

DBGET integrated database retrieval system