Burkholderia oklahomensis C6786: BG90_3431 Help Entry BG90_3431         CDS       T03861                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism boc  Burkholderia oklahomensis C6786 Pathway boc00261   Monobactam biosynthesis boc01100   Metabolic pathways boc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:boc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BG90_3431  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:boc01008]     BG90_3431 Polyketide biosynthesis proteins [BR:boc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BG90_3431 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJX32027 UniProt:  A0A7U4UMV5 LinkDB All DBs Position I:complement(3861784..3862038) Genome browser AA seq 84 aa AA seqDB search MTQAQQPSNPPAAAAADADDIVYTVVVNDEEQYSIWPTFRAVPAGWRETGVRGPKADCLA HIETVWTDMRPASLRRHLDAANAS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaaccctcgaacccgccggccgccgcggccgccgacgccgacgac atcgtctacacggtcgtcgtcaacgacgaagagcagtactcgatctggccgacgttccgc gcggtgccggccggctggcgcgaaaccggcgtgcgcggcccgaaggccgactgcctcgcg cacatcgagaccgtgtggaccgacatgcgtcccgcgagcctgcgccgccatctggacgcg gcgaacgcgtcgtaa

DBGET integrated database retrieval system