Burkholderia oklahomensis C6786: BG90_4003 Help Entry BG90_4003         CDS       T03861                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism boc  Burkholderia oklahomensis C6786 Pathway boc00261   Monobactam biosynthesis boc01100   Metabolic pathways boc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:boc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BG90_4003  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:boc01008]     BG90_4003 Polyketide biosynthesis proteins [BR:boc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BG90_4003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJX34803 UniProt:  A0A7U4UVF3 LinkDB All DBs Position II:446945..447145 Genome browser AA seq 66 aa AA seqDB search MTNLLDDPEGSFFVLSNAEGQHSLWPASIALPAGWTVVFGQDARQPCIDYIDTHWTDLAP RRPRAA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgactaatctgctcgacgatcccgaaggctcgttcttcgtgctgtcgaacgccgaagga caacactcgctctggccggcgtcgatcgcgctgcccgccggctggaccgtcgtctttggg caggacgcgcggcaaccgtgcatcgactacatcgacacgcactggaccgacctggccccg cgccgcccgcgcgcggcctga

DBGET integrated database retrieval system