Bactrocera oleae (olive fruit fly): 106618101 Help Entry 106618101         CDS       T07646                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04013   MAPK signaling pathway - fly bod04068   FoxO signaling pathway bod04137   Mitophagy - animal bod04140   Autophagy - animal bod04150   mTOR signaling pathway bod04213   Longevity regulating pathway - multiple species bod04214   Apoptosis - fly bod04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:bod00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106618101    04068 FoxO signaling pathway     106618101    04150 mTOR signaling pathway     106618101  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106618101    04137 Mitophagy - animal     106618101   09143 Cell growth and death    04214 Apoptosis - fly     106618101  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     106618101   09149 Aging    04213 Longevity regulating pathway - multiple species     106618101  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bod04131]     106618101   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bod04031]     106618101 Membrane trafficking [BR:bod04131]  Endocytosis   Macropinocytosis    Ras GTPases     106618101 GTP-binding proteins [BR:bod04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106618101 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin TPP_enzyme_M Ldh_1_N Motif Other DBs NCBI-GeneID:  106618101 NCBI-ProteinID:  XP_014091147 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QAWAVNMNQAREVAKQYGIPFVETSAKTRMGVDDAFYTLVREIRKDKEHRGKKGRKHHKL PHHKFKCELL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaaattagtggttgtaggtgctggaggtgttggtaaatctgcccttaca atccagttaatacaaaatcattttgtggatgaatacgatccaacaattgaagattcttat aggaagcaagtggttatagatggtgaaacgtgtctgttggatattttagatacagctggt caagaggagtattcagctatgcgtgatcaatatatgcgaactggagagggatttctgctc gtttttgctgttaatagtgcgaagtcatttgaagatattggcacatatcgagagcaaata aagcgcgtaaaagacgcggaagaggtaccaatggtgctggtaggaaataagtgcgatctg caagcctgggcagttaatatgaaccaagccagagaggttgctaaacaatacggcattcca tttgttgagacatccgccaagacacgaatgggcgtagatgacgctttttacacattagtc cgtgagattcgaaaggataaagagcatagggggaaaaaaggtcgcaaacatcataagcta ccacatcataaattcaaatgcgaattgctgtaa

DBGET integrated database retrieval system