Bordetella sp. H567: AKI39_22700 Help Entry AKI39_22700       CDS       T04979                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism boh  Bordetella sp. H567 Pathway boh00790   Folate biosynthesis boh01100   Metabolic pathways boh01240   Biosynthesis of cofactors Module boh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:boh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AKI39_22700 Enzymes [BR:boh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AKI39_22700  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AKI39_22700  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AKI39_22700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB AcMNPV_Orf18 Motif Other DBs NCBI-ProteinID:  AOB32953 UniProt:  A0A1B2R7M7 LinkDB All DBs Position 5078377..5078736 Genome browser AA seq 119 aa AA seqDB search MPTRRIVFSRLALDARIGILEHERRATQPLHVDAEIDVDITRSVDDHDIHSVLDYRALRE AIVAECTHAHVNLIETLTERVAERLMADFEEIRAVRIRISKPMAFSDCAAVGVEIYTSR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcctactcgccgcatcgttttttcccgccttgccctggacgcccgcatcggcatcctg gaacacgagcgccgcgccacgcagccgcttcacgtcgacgccgagatcgatgtggacatt acccgcagcgtggacgaccatgacatccatagcgtgctggactaccgcgccctgcgcgag gccatcgtcgccgaatgcacccacgcccacgtgaacctgatcgaaacgctgaccgagcgg gtggccgagcgcctgatggcggatttcgaggaaatccgcgccgtgcgcatccgcatcagc aagcccatggcgttttccgactgcgccgccgtcggcgtggaaatctatacgtcgcgctga

DBGET integrated database retrieval system