Bosea sp. Tri-49: BLM15_24650 Help Entry BLM15_24650       CDS       T05753                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism boi  Bosea sp. Tri-49 Pathway boi00790   Folate biosynthesis boi01100   Metabolic pathways boi01240   Biosynthesis of cofactors Module boi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:boi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BLM15_24650 Enzymes [BR:boi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BLM15_24650  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BLM15_24650  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BLM15_24650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AZO80400 LinkDB All DBs Position complement(5150660..5151034) Genome browser AA seq 124 aa AA seqDB search MSATGQIFIEALDLYAYHGHFAEEGRLGQRFSMDLVLDCDLRASSLSDSLADTVDYGEVV ALVTRTFSGKRFKLLEAAARALADAILAGYPAVTKVAVTLRKPAPPIPGRMESVGIKLDF TREG NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgacggggcagatcttcatcgaggcgctcgacctctacgcctatcacgggcat ttcgccgaggagggccggctcggccagcgtttctcgatggacctcgtcctggattgcgac ctgcgcgcttcctcgctcagcgacagccttgccgacacggtcgactatggcgaggtcgtc gcgctggtcacgcgcaccttttcggggaagcgtttcaagctgctcgaggcggcagcgcgg gcgctcgcggacgccatcctggcgggataccccgccgtgaccaaggtcgcggtcaccttg cgcaagccggccccgccgatccccggacggatggaatcggtcgggatcaagctggatttc acgcgtgagggttga

DBGET integrated database retrieval system