Burkholderia oklahomensis E0147: DM82_4024 Help Entry DM82_4024         CDS       T03284                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bok  Burkholderia oklahomensis E0147 Pathway bok00261   Monobactam biosynthesis bok01100   Metabolic pathways bok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bok00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM82_4024 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bok01008]     DM82_4024 (mbtH) Polyketide biosynthesis proteins [BR:bok01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM82_4024 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO68875 LinkDB All DBs Position 2:complement(313393..313593) Genome browser AA seq 66 aa AA seqDB search MTNLLDDPEGSFFVLSNAEGQHSLWPASIALPAGWTVVFGQDARQPCIDYIDTHWTDLAP RRPRAA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgactaatctgctcgacgatcccgaaggctcgttcttcgtgctgtcgaacgccgaagga caacactcgctctggccggcgtcgatcgcgctgcccgccggctggaccgtcgtctttggg caggacgcgcggcaaccgtgcatcgactacatcgacacgcactggaccgacctggccccg cgccgcccgcgcgcggcctga

DBGET integrated database retrieval system