Burkholderia oklahomensis E0147: DM82_5251 Help Entry DM82_5251         CDS       T03284                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bok  Burkholderia oklahomensis E0147 Pathway bok00261   Monobactam biosynthesis bok01100   Metabolic pathways bok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bok00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM82_5251  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bok01008]     DM82_5251 Polyketide biosynthesis proteins [BR:bok01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM82_5251 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO70749 LinkDB All DBs Position 2:complement(1803879..1804103) Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGKPATKQQCLQRIEQLWTDMVPASVREH LNQHSGSGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtatttcgtagtgcgaaacaatgagggccagtattcggtctggatg gatgggcgaagcctccccgccggctgggaaacggtcggtaaacctgcgacgaagcagcag tgcctgcaacgcatcgagcaactctggacggacatggttcctgccagcgtccgcgagcat ctcaatcaacattcgggctcgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system