Bos mutus (wild yak): 106701394 Help Entry 106701394         CDS       T02919                                  Name (RefSeq) tubulin beta-4B chain-like   KO K07375   tubulin beta Organism bom  Bos mutus (wild yak) Pathway bom04145   Phagosome bom04540   Gap junction bom04814   Motor proteins bom05010   Alzheimer disease bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05016   Huntington disease bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bom00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106701394   09144 Cellular community - eukaryotes    04540 Gap junction     106701394   09142 Cell motility    04814 Motor proteins     106701394  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106701394   09164 Neurodegenerative disease    05010 Alzheimer disease     106701394    05012 Parkinson disease     106701394    05014 Amyotrophic lateral sclerosis     106701394    05016 Huntington disease     106701394    05020 Prion disease     106701394    05022 Pathways of neurodegeneration - multiple diseases     106701394  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     106701394   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     106701394    04147 Exosome [BR:bom04147]     106701394 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      106701394 Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     106701394 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106701394   Exosomal proteins of colorectal cancer cells    106701394   Exosomal proteins of bladder cancer cells    106701394 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Motif Other DBs NCBI-GeneID:  106701394 NCBI-ProteinID:  XP_014337411 LinkDB All DBs Position Un AA seq 173 aa AA seqDB search MSYQTSAGSLHGPQAETNAQVKTVPLTVRAAGLLTAPPSFPACLPDMAPQKLLEEQGGSC GPFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVR SGPFGQIFRPDNFVFGQGQPAEAAAALPLQSSPEQEGREQRVKESFQQRQNKE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtcttaccaaacatcggccggctccctgcacgggccgcaggctgaaacaaacgctcag gtgaagactgtacccttgacggttcgggctgccgggctgctaacggcccctcccagcttc ccagcctgtctccctgacatggctccgcagaagctgctggaggagcagggtggcagctgc gggcctttttgggaagtcatcagcgatgagcatggcatcgaccccactggcagttaccat ggagacagtgacttgcagctggagagaatcaacgtgtactacaacgaggctgctggtaac aagtatgtgcctcgggccatcctggtggacctggagccgggcaccatggactccgtcagg tctggacccttcggccagatcttcaggcctgacaacttcgtgtttggccagggtcagcct gcagaggctgccgcagccctcccactgcagagcagcccagagcaggagggcagagaacaa agagtgaaggaaagcttccagcagcggcagaacaaagagtga

DBGET integrated database retrieval system