Bordetella parapertussis 12822: BPP4147 Help Entry BPP4147           CDS       T00140                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bpa  Bordetella parapertussis 12822 Pathway bpa00790   Folate biosynthesis bpa01100   Metabolic pathways bpa01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:bpa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BPP4147 (folB) Enzymes [BR:bpa01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BPP4147 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BPP4147 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BPP4147 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB AcMNPV_Orf18 Motif Other DBs NCBI-ProteinID:  CAE39426 UniProt:  Q7W399 LinkDB All DBs Position 4482691..4483050 Genome browser AA seq 119 aa AA seqDB search MPTRRIFISGLALDARIGILEHERRATQPLHIDAEFDIDIMRNVDDHDIHSVLDYRRLRE AIVEECTQAHVNLIETLTEQVAARLLADFDEIRSLRLRVSKPMAFSDCAAVGVEIQISR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcctacacgccgcatattcatctccgggctggccctggacgcccgcatcggcattctt gaacacgaacgccgcgccacccagccgctgcatatcgacgccgagttcgacatcgacatc atgcgcaacgtggacgaccacgacatccacagcgtgctcgactaccggcggctgcgcgag gccatcgtcgaagaatgcacgcaggcccatgtcaacctgatcgagacgctgaccgaacag gtcgccgcgcgcctgctggccgatttcgacgagatccgctcgctgcgcctgcgcgtcagc aagcccatggccttctcggattgcgcggcggtcggcgtggagatacagatcagccgctaa

DBGET integrated database retrieval system