Burkholderia pseudomallei 668: BURPS668_1918 Help Entry BURPS668_1918     CDS       T00481                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism bpd  Burkholderia pseudomallei 668 Pathway bpd00261   Monobactam biosynthesis bpd01100   Metabolic pathways bpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BURPS668_1918  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpd01008]     BURPS668_1918 Polyketide biosynthesis proteins [BR:bpd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BURPS668_1918 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABN84566 LinkDB All DBs Position I:1877994..1878236 Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPAGADDVVYAVVVNDEEQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccggcgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaagagcagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system