Paraburkholderia phymatum: Bphy_4046 Help Entry Bphy_4046         CDS       T00704                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bph  Paraburkholderia phymatum Pathway bph00261   Monobactam biosynthesis bph01100   Metabolic pathways bph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bph00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Bphy_4046  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bph01008]     Bphy_4046 Polyketide biosynthesis proteins [BR:bph01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Bphy_4046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACC73169 UniProt:  B2JPH8 LinkDB All DBs Position 2:complement(1041030..1041263) Genome browser AA seq 77 aa AA seqDB search MTQNTHQDAQDDVQYTVVVNDEEQYSIWPTFRDVPAGWREVGVRGPKAACLEHIEAVWTD MRPASLRRHMDAAPNTR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacccagaacacacatcaagacgcacaggacgacgttcaatacacagtcgtcgtcaac gacgaagaacaatattcgatctggccgacgtttcgcgacgtgcctgccggctggcgcgaa gtcggtgtgcgcgggccgaaggccgcctgcctcgaacatatcgaagccgtctggacggat atgcgtcccgcgagcctgcgccgtcacatggacgccgcgccgaacacgcgctga

DBGET integrated database retrieval system