Burkholderia pseudomallei 1106a: BURPS1106A_1932 Help Entry BURPS1106A_1932   CDS       T00480                                  Name (GenBank) mbtH domain protein   KO K05375   MbtH protein Organism bpl  Burkholderia pseudomallei 1106a Pathway bpl00261   Monobactam biosynthesis bpl01100   Metabolic pathways bpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BURPS1106A_1932  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpl01008]     BURPS1106A_1932 Polyketide biosynthesis proteins [BR:bpl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BURPS1106A_1932 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABN90805 UniProt:  A3NV26 LinkDB All DBs Position I:1883904..1884146 Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPADADDVVYAVVVNDEEQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgacgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaagaacagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system