Burkholderia pseudomallei 1106a: BURPS1106A_A1707 Help Entry BURPS1106A_A1707  CDS       T00480                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism bpl  Burkholderia pseudomallei 1106a Pathway bpl00261   Monobactam biosynthesis bpl01100   Metabolic pathways bpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BURPS1106A_A1707 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpl01008]     BURPS1106A_A1707 (mbtH) Polyketide biosynthesis proteins [BR:bpl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BURPS1106A_A1707 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABN92938 UniProt:  A3P5Y1 LinkDB All DBs Position II:complement(1673636..1673842) Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgacggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggccggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system