Brachyspira pilosicoli 95/1000: BP951000_1522 Help Entry BP951000_1522     CDS       T01278                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bpo  Brachyspira pilosicoli 95/1000 Pathway bpo00020   Citrate cycle (TCA cycle) bpo01100   Metabolic pathways bpo01110   Biosynthesis of secondary metabolites bpo01120   Microbial metabolism in diverse environments bpo01200   Carbon metabolism bpo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bpo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BP951000_1522 Enzymes [BR:bpo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BP951000_1522 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_21 Fer4_10 Fer4_6 Fer4_15 Fer4_9 Fer4_16 Fer4_13 Fer4_8 Fer4_17 Fer4_3 Fer4_22 Fer4_4 Motif Other DBs NCBI-ProteinID:  ADK31505 UniProt:  D8IED2 LinkDB All DBs Position 1653259..1653495 Genome browser AA seq 78 aa AA seqDB search MAKGRVIIDSEQCKGCSNCVSVCPTKILYLDKENMNSWGYYPAAVTDMEKCIGCANCAMM CPDICIKVERLDEKKEGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtcgtgttattattgatagtgaacaatgtaagggttgttctaattgtgta tctgtatgtcctaccaagatattgtatttagataaggaaaatatgaattcttgggggtat tatcctgcagcggttacagacatggagaaatgtataggctgtgctaactgtgccatgatg tgcccagatatatgtataaaagtagagagacttgatgagaagaaggagggtaaataa

DBGET integrated database retrieval system