Burkholderia pseudomallei MSHR346: GBP346_A2037 Help Entry GBP346_A2037      CDS       T00894                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bpr  Burkholderia pseudomallei MSHR346 Pathway bpr00261   Monobactam biosynthesis bpr01100   Metabolic pathways bpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GBP346_A2037  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpr01008]     GBP346_A2037 Polyketide biosynthesis proteins [BR:bpr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GBP346_A2037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACQ95136 LinkDB All DBs Position I:1986268..1986492 Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system