Burkholderia pseudomallei K96243: BPSS1267 Help Entry BPSS1267          CDS       T00203                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism bps  Burkholderia pseudomallei K96243 Pathway bps00261   Monobactam biosynthesis bps01100   Metabolic pathways bps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bps00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BPSS1267  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bps01008]     BPSS1267 Polyketide biosynthesis proteins [BR:bps01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BPSS1267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAH38734 UniProt:  Q63KU7 LinkDB All DBs Position 2:complement(1719868..1720074) Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgacggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggccggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system