Burkholderia pseudomallei NAU35A-3: BBU_421 Help Entry BBU_421           CDS       T03476                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpsa  Burkholderia pseudomallei NAU35A-3 Pathway bpsa00261   Monobactam biosynthesis bpsa01100   Metabolic pathways bpsa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBU_421  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsa01008]     BBU_421 Polyketide biosynthesis proteins [BR:bpsa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBU_421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIS88085 LinkDB All DBs Position 1:complement(506875..507099) Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggagaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system