Burkholderia pseudomallei MSHR520: BBX_2183 Help Entry BBX_2183          CDS       T03163                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpsd  Burkholderia pseudomallei MSHR520 Pathway bpsd00261   Monobactam biosynthesis bpsd01100   Metabolic pathways bpsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBX_2183  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsd01008]     BBX_2183 Polyketide biosynthesis proteins [BR:bpsd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBX_2183 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHK64679 LinkDB All DBs Position 1:complement(2430249..2430473) Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system