Burkholderia pseudomallei MSHR520: BBX_3722 Help Entry BBX_3722          CDS       T03163                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bpsd  Burkholderia pseudomallei MSHR520 Pathway bpsd00261   Monobactam biosynthesis bpsd01100   Metabolic pathways bpsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBX_3722 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsd01008]     BBX_3722 (mbtH) Polyketide biosynthesis proteins [BR:bpsd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBX_3722 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHK69627 LinkDB All DBs Position 2:complement(233027..233233) Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgacggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggccggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system