Burkholderia pseudomallei MSHR305: BDL_310 Help Entry BDL_310           CDS       T02756                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpse  Burkholderia pseudomallei MSHR305 Pathway bpse00261   Monobactam biosynthesis bpse01100   Metabolic pathways bpse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpse00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BDL_310  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpse01008]     BDL_310 Polyketide biosynthesis proteins [BR:bpse01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BDL_310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGR73402 LinkDB All DBs Position 2:complement(401435..401677) Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPADADDVVYAVVVNDEEQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgacgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaagaacagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system