Burkholderia pseudomallei MSHR305: BDL_4559 Help Entry BDL_4559          CDS       T02756                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bpse  Burkholderia pseudomallei MSHR305 Pathway bpse00261   Monobactam biosynthesis bpse01100   Metabolic pathways bpse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpse00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BDL_4559 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpse01008]     BDL_4559 (mbtH) Polyketide biosynthesis proteins [BR:bpse01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BDL_4559 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGR68421 LinkDB All DBs Position 1:complement(1334843..1335049) Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgacggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggccggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system