Burkholderia pseudomallei HBPUB10134a: DR55_2818 Help Entry DR55_2818         CDS       T03422                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpsh  Burkholderia pseudomallei HBPUB10134a Pathway bpsh00261   Monobactam biosynthesis bpsh01100   Metabolic pathways bpsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DR55_2818  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsh01008]     DR55_2818 Polyketide biosynthesis proteins [BR:bpsh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DR55_2818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIP52385 LinkDB All DBs Position 1:complement(3237689..3237913) Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacagtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system