Burkholderia pseudomallei HBPUB10134a: DR55_4020 Help Entry DR55_4020         CDS       T03422                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bpsh  Burkholderia pseudomallei HBPUB10134a Pathway bpsh00261   Monobactam biosynthesis bpsh01100   Metabolic pathways bpsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DR55_4020 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsh01008]     DR55_4020 (mbtH) Polyketide biosynthesis proteins [BR:bpsh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DR55_4020 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIP54161 LinkDB All DBs Position 2:739450..739656 Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgacggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggccggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system