Burkholderia pseudomallei MSHR511: BBQ_1585 Help Entry BBQ_1585          CDS       T03012                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpsm  Burkholderia pseudomallei MSHR511 Pathway bpsm00261   Monobactam biosynthesis bpsm01100   Metabolic pathways bpsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBQ_1585  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsm01008]     BBQ_1585 Polyketide biosynthesis proteins [BR:bpsm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBQ_1585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHG33230 LinkDB All DBs Position 1:complement(1814274..1814498) Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggagaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system