Burkholderia pseudomallei A79A: X996_2441 Help Entry X996_2441         CDS       T03498                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpso  Burkholderia pseudomallei A79A Pathway bpso00261   Monobactam biosynthesis bpso01100   Metabolic pathways bpso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpso00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     X996_2441  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpso01008]     X996_2441 Polyketide biosynthesis proteins [BR:bpso01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     X996_2441 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIV96815 LinkDB All DBs Position 1:complement(2767251..2767475) Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system