Burkholderia pseudomallei MSHR146: BBN_1773 Help Entry BBN_1773          CDS       T03024                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bpsu  Burkholderia pseudomallei MSHR146 Pathway bpsu00261   Monobactam biosynthesis bpsu01100   Metabolic pathways bpsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBN_1773  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsu01008]     BBN_1773 Polyketide biosynthesis proteins [BR:bpsu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBN_1773 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHG66353 LinkDB All DBs Position 1:complement(2051005..2051247) Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPADADDVVYAVVVNDEEQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgacgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaagagcagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system