Burkholderia pseudomallei MSHR146: BBN_4699 Help Entry BBN_4699          CDS       T03024                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bpsu  Burkholderia pseudomallei MSHR146 Pathway bpsu00261   Monobactam biosynthesis bpsu01100   Metabolic pathways bpsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpsu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBN_4699 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpsu01008]     BBN_4699 (mbtH) Polyketide biosynthesis proteins [BR:bpsu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBN_4699 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHG71918 LinkDB All DBs Position 2:complement(1526239..1526445) Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgatggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggctggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system