Bacillus pumilus SAFR-032: BPUM_0062 Help Entry BPUM_0062         CDS       T00599                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bpu  Bacillus pumilus SAFR-032 Pathway bpu00790   Folate biosynthesis bpu01100   Metabolic pathways bpu01240   Biosynthesis of cofactors Module bpu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bpu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BPUM_0062 Enzymes [BR:bpu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BPUM_0062  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BPUM_0062  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BPUM_0062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABV60762 UniProt:  A8F945 LinkDB All DBs Position 89098..89436 Genome browser AA seq 112 aa AA seqDB search MEFYGYHGVFAEENKLGQRFRVDLTASLDLSKAGQTDDLNETINYAELYQICKSIVEGES VNLVETLTERIASQVLKDFLTVQECTVKVIKPDPPIPGHYQSVAIEMTRSRA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggaattttacggctaccatggcgtatttgcagaagaaaataaattaggacagcggttc cgcgtggatttaacagcttcacttgatttaagtaaagccggacaaactgatgacctcaat gagaccatcaattatgcggagctctaccaaatctgcaaaagcattgtagagggtgaatca gtcaacctcgttgaaacactaacagaaagaattgcaagccaagtgttaaaggactttctg acagttcaggaatgcactgtgaaggtgattaaaccagatccgccaattccaggacactat cagtccgttgccattgaaatgacgagatcgcgcgcatga

DBGET integrated database retrieval system