Paraburkholderia phenoliruptrix: BUPH_01751 Help Entry BUPH_01751        CDS       T02300                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism bpx  Paraburkholderia phenoliruptrix Pathway bpx00261   Monobactam biosynthesis bpx01100   Metabolic pathways bpx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BUPH_01751  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpx01008]     BUPH_01751 Polyketide biosynthesis proteins [BR:bpx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BUPH_01751 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFT85327 UniProt:  K0DKQ4 LinkDB All DBs Position 1:1381550..1381783 Genome browser AA seq 77 aa AA seqDB search MSWGDEKSNFVVVVNHEEQYSIWPDYKAIPAGWREAGKSGKKDECLQWIDEVWTDMRPLS LRQAMAGSAGPEGVTNA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagctggggtgacgaaaagagcaatttcgttgtcgttgtcaatcacgaggaacagtat tcgatctggcctgactacaaggccattccggccggttggcgcgaagcaggcaagtctggc aagaaagacgagtgcctgcaatggatcgacgaggtgtggaccgacatgcgtccgttgagc ttgcgtcaggcaatggccggcagcgcagggcccgaaggcgtcacgaacgcctga

DBGET integrated database retrieval system