Bradyrhizobium sp. C-145: LRP30_13110 Help Entry LRP30_13110       CDS       T09672                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism braz  Bradyrhizobium sp. C-145 Pathway braz00790   Folate biosynthesis braz01100   Metabolic pathways braz01240   Biosynthesis of cofactors Module braz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:braz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LRP30_13110 (folB) Enzymes [BR:braz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LRP30_13110 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LRP30_13110 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LRP30_13110 (folB) BRITE hierarchy Motif Pfam:  FolB GPW_gp25 Uricase Motif Other DBs NCBI-ProteinID:  UQR66128 LinkDB All DBs Position complement(2857457..2857825) Genome browser AA seq 122 aa AA seqDB search MTDTIFVTGLSIHARHGVMDHETEVGQRFVIDLELYTDLSEPSRSDRLADTVSYAEVVAT TTAAFKNTNYKLLERAAGAVADAILSHFPRIRAVKITVHKPHAPIAAIFDDVGIMLTRSR HP NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaccgatacgatcttcgtgaccggcctgtcgatccatgcccgccacggcgtcatggat cacgaaaccgaagtcggccagcgcttcgtcatcgatctcgaactctataccgacctgtcg gagccttcgcgcagcgaccggctcgccgacaccgtctcgtacgccgaggtcgtggcgacc accacggcggcgttcaagaacaccaactacaagctcttggagcgcgcggccggcgcggtc gccgatgccatcctgtcgcatttcccgcgcatccgcgccgtgaagatcaccgtgcacaag ccgcatgcgccgatcgccgcgatcttcgacgacgtcggcatcatgctgacgcgctcgcgg catccctaa

DBGET integrated database retrieval system