Brevundimonas sp. LM2: BZG35_15790 Help Entry BZG35_15790       CDS       T04750                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism brl  Brevundimonas sp. LM2 Pathway brl00790   Folate biosynthesis brl01100   Metabolic pathways brl01240   Biosynthesis of cofactors Module brl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:brl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BZG35_15790 Enzymes [BR:brl01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BZG35_15790  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BZG35_15790  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BZG35_15790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AQR63584 UniProt:  A0A1S6F047 LinkDB All DBs Position complement(3180118..3180456) Genome browser AA seq 112 aa AA seqDB search MTIFVQGLIVEAGIGVYDHEHGRLQTLLIDVSLDLGPAEVHGLADTVNYESVAAACRRIV AEGHVGLVETFAERLALDCLTDPRVLAVTVRVDKPGALEAAAGAGCELRYRR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt ctgaccatcttcgtccagggcctgatcgtcgaggcgggcatcggcgtctatgaccacgaa cacggccggctgcagaccctgctgatcgacgtgagcctggatctggggccggccgaggtg cacggcctggccgatacggtgaactatgagagcgtcgccgccgcctgccgccgcatcgtc gccgagggccatgtggggctggtggagaccttcgccgagcggctggccctggactgtctg accgatccccgcgtcctggccgtgaccgtgcgtgtcgacaagcccggagcgctggaggcc gccgccggggccggatgcgaactgcgctatcgtcgctga

DBGET integrated database retrieval system