Bradyrhizobium sp. ORS 285: BRAD285_5053 Help Entry BRAD285_5053      CDS       T04956                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bro  Bradyrhizobium sp. ORS 285 Pathway bro00261   Monobactam biosynthesis bro01100   Metabolic pathways bro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BRAD285_5053  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bro01008]     BRAD285_5053 Polyketide biosynthesis proteins [BR:bro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BRAD285_5053 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  SMX59882 UniProt:  A0A1Y6KJK8 LinkDB All DBs Position complement(5045485..5045721) Genome browser AA seq 78 aa AA seqDB search MMVFDRDDVTFTVVVNHEEQYSIWPTFKDIPNGWTAVGVTGSKKECLDHIERVWTDMRPL SLRKFMQDNSQGTPAAQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgatggtcttcgacagagacgacgtcaccttcaccgtcgtcgtgaatcacgaagagcaa tattcgatctggccgacgttcaaggacatcccgaacggctggactgctgtcggcgtgacc ggcagcaagaaggaatgtctggaccatatcgagcgggtctggaccgacatgcggccgctc tcgctgcgcaagttcatgcaggacaattctcaaggcacaccggcagcgcaatcctga

DBGET integrated database retrieval system