Bipolaris sorokiniana: COCSADRAFT_46851 Help Entry COCSADRAFT_46851  CDS       T03124                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism bsc  Bipolaris sorokiniana Pathway bsc03020   RNA polymerase bsc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bsc00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     COCSADRAFT_46851   09124 Replication and repair    03420 Nucleotide excision repair     COCSADRAFT_46851  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bsc03021]     COCSADRAFT_46851    03400 DNA repair and recombination proteins [BR:bsc03400]     COCSADRAFT_46851 Transcription machinery [BR:bsc03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      COCSADRAFT_46851   RNA polymerase III system    RNA polymerase III      COCSADRAFT_46851   RNA polymerase I system    RNA polymerase I      COCSADRAFT_46851 DNA repair and recombination proteins [BR:bsc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       COCSADRAFT_46851 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  19140220 NCBI-ProteinID:  XP_007703144 JGI:  Cocsa1_46851 UniProt:  M2SEG9 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MIVPIRCFSCGKVTGDLWEKYMALLSDGMEEAEALDSVGLQRYCCRRMILTHVDLIEKLL KYNASEREQARAAR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgtcccgatccgttgcttttcttgtggcaaggtcaccggcgacctgtgggagaaa tacatggcacttctcagtgatggcatggaggaagctgaagcactcgatagtgtcggtctt cagcgctactgctgccgccgcatgattctcactcacgtcgatctgatcgagaagcttctg aagtacaacgccagcgaacgagaacaagcccgcgcggcccgc

DBGET integrated database retrieval system