Bacillus shivajii: LGQ02_18645 Help Entry LGQ02_18645       CDS       T07881                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bshi  Bacillus shivajii Pathway bshi00020   Citrate cycle (TCA cycle) bshi01100   Metabolic pathways bshi01110   Biosynthesis of secondary metabolites bshi01120   Microbial metabolism in diverse environments bshi01200   Carbon metabolism bshi01210   2-Oxocarboxylic acid metabolism Module bshi_M00009   Citrate cycle (TCA cycle, Krebs cycle) bshi_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:bshi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LGQ02_18645 Enzymes [BR:bshi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LGQ02_18645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_6 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_22 Fer4_8 Fer4_13 Fer4_3 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  UCZ52778 LinkDB All DBs Position 3851402..3851629 Genome browser AA seq 75 aa AA seqDB search MRVYFEEDYCKGCSLCISVCPQEIIHLADRMNNKGYRPTEVLEQDKCTSCTACARICPDA VITVYRPEKKKKKAS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagggtttattttgaagaagattattgtaaagggtgcagcttatgtatttctgtctgt ccacaagaaattattcacttagcagatcgcatgaataacaaagggtatagacctaccgaa gtacttgaacaggacaaatgcacaagctgtacagcttgcgcaagaatttgccctgatgct gtcatcaccgtttatcgaccagaaaagaaaaaaaagaaggcatcttaa

DBGET integrated database retrieval system