Bacillus subtilis BSn5: BSn5_06865 Help Entry BSn5_06865        CDS       T01417                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bsn  Bacillus subtilis BSn5 Pathway bsn00261   Monobactam biosynthesis bsn01100   Metabolic pathways bsn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BSn5_06865  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bsn01008]     BSn5_06865 Polyketide biosynthesis proteins [BR:bsn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BSn5_06865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADV93999 LinkDB All DBs Position complement(1287891..1288100) Genome browser AA seq 69 aa AA seqDB search MANPFENADGIYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKTVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcatatatttggtgctggtcaatgaagaaggc caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system