Bacillus subtilis subsp. natto BEST195: BSNT_09658 Help Entry BSNT_09658        CDS       T02607                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bso  Bacillus subtilis subsp. natto BEST195 Pathway bso00261   Monobactam biosynthesis bso01100   Metabolic pathways bso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bso00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BSNT_09658  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bso01008]     BSNT_09658 Polyketide biosynthesis proteins [BR:bso01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BSNT_09658 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAI86719 UniProt:  D4G0T8 LinkDB All DBs Position complement(3041855..3042064) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKAVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagaaggc caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca aacagcctaaaggctgttgaaaatgtgtaa

DBGET integrated database retrieval system